Anti-Envelopment polyprotein [RV-Gn3], Rabbit IgG, kappa
AB04482-23.0
ApplicationsELISA, Neutralisation/Blocking, Other Application
Product group Antibodies
ReactivityVirus
Overview
- SupplierAbsolute Antibody
- Product NameAnti-Envelopment polyprotein [RV-Gn3], Rabbit IgG, kappa
- Delivery Days Customer9
- Antibody SpecificityThis antibody is specific for the sequence SQCPKIGGHGSKKCTGDAAFCSAYECTAQYAN of glycoprotein N from Rift valley fever virus.
- Application Supplier NoteThe original antibody was used for an ELISA on glycoprotein N from Rift valley fever virus. This antibody has also shown the ability to neutralize Rift valley fever virus in a plaque reduction assay. The structure of the original antibody was determined using x-ray crystallography (Allen et al., 2018; PMID:30590046).
- ApplicationsELISA, Neutralisation/Blocking, Other Application
- CertificationResearch Use Only
- ClonalityMonoclonal
- Clone IDRV-Gn3
- HostRabbit
- IsotypeIgG
- ReactivityVirus
- Storage Instruction-20°C,2°C to 8°C
- UNSPSC12352203