Anti-SUR1 [N289/16]

Absolute Antibody

Anti-SUR1 [N289/16]

7

This antibody is specific for the SUR1 protein. It does not cross-react with SUR2B. SUR1 is a subunit of the beta-cell ATP-sensitive potassium channel (KATP). Regulator of ATP-sensitive K+ channels and insulin release.

The IgG1 antibody was used for western blotting on CA1S cells (Bruin et al, 2014; PMID:24257076). Immunofluorescense was preformed with the IgG1 version of this antibody on HeLa cells (Karnik et al, 2013; PMID:24392021). The IgG1 version of this antibody was used to preform western blot on COS6m cells (Li et al, 2013; PMID:23798684).

Western Blot

WB

Research Use Only

Monoclonal

N289/16

Abcc8

ATP binding cassette subfamily C member 8

ATP-binding cassette sub-family C member 8; ATP-binding cassette transporter sub-family C member 8; ATP-binding cassette, subfamily C (CFTR/MRP), member 8; ATP-binding cassette, sub-family C (CFTR/MRP), member 8; sulfonylurea receptor 1; sulphonylurea receptor 1; Sur; Sur1

Mouse

IgG2a

ATP-binding cassette sub-family C member 8

Hamster, Mouse, Rat

rat, mouse, hamster

This antibody was raised by immunising BALB/c mice with a fusion protein amino acids 1548-1582 (LVMVLKRGAILEFDKPEKLLSQKDSVFASFVRADK, cytoplasmic C-terminus) of rat SUR1.

-20°C,2°C to 8°C

12352203