Bio-Connect

Anti-SUR1 [N289/16]

Ab02165-8.4
Absolute Antibody
ApplicationsWestern Blot
Product group Antibodies
ReactivityHamster, Mouse, Rat
TargetAbcc8
Sign in to order and to see your custom pricing.
Large volume orders?
Order with a bulk request

Overview

  • Supplier
    Absolute Antibody
  • Product Name
    Anti-SUR1 [N289/16]
  • Delivery Days Customer
    7
  • Antibody Specificity
    This antibody is specific for the SUR1 protein. It does not cross-react with SUR2B. SUR1 is a subunit of the beta-cell ATP-sensitive potassium channel (KATP). Regulator of ATP-sensitive K+ channels and insulin release.
  • Application Supplier Note
    The IgG1 antibody was used for western blotting on CA1S cells (Bruin et al, 2014; PMID:24257076). Immunofluorescense was preformed with the IgG1 version of this antibody on HeLa cells (Karnik et al, 2013; PMID:24392021). The IgG1 version of this antibody was used to preform western blot on COS6m cells (Li et al, 2013; PMID:23798684).
  • Applications
    Western Blot
  • Applications Supplier
    WB
  • Certification
    Research Use Only
  • Clonality
    Monoclonal
  • Clone ID
    N289/16
  • Gene ID25559
  • Target name
    Abcc8
  • Target description
    ATP binding cassette subfamily C member 8
  • Target synonyms
    ATP-binding cassette sub-family C member 8; ATP-binding cassette transporter sub-family C member 8; ATP-binding cassette, subfamily C (CFTR/MRP), member 8; ATP-binding cassette, sub-family C (CFTR/MRP), member 8; sulfonylurea receptor 1; sulphonylurea receptor 1; Sur; Sur1
  • Host
    Rat
  • Isotype
    IgG2b
  • Protein IDQ09429
  • Protein Name
    ATP-binding cassette sub-family C member 8
  • Scientific Description
    This chimeric rat antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques.
  • Reactivity
    Hamster, Mouse, Rat
  • Reactivity Supplier
    rat, mouse, hamster
  • Reactivity Supplier Note
    This antibody was raised by immunising BALB/c mice with a fusion protein amino acids 1548-1582 (LVMVLKRGAILEFDKPEKLLSQKDSVFASFVRADK, cytoplasmic C-terminus) of rat SUR1.
  • Storage Instruction
    -20°C,2°C to 8°C
  • UNSPSC
    12352203