Anti-SUR2B [N323B/20]
Ab02169-23.0
ApplicationsWestern Blot, ImmunoCytoChemistry, ImmunoHistoChemistry
Product group Antibodies
ReactivityRat
TargetAbcc9
Overview
- SupplierAbsolute Antibody
- Product NameAnti-SUR2B [N323B/20]
- Delivery Days Customer7
- Antibody SpecificityThis antibody is specific for the SUR2B protein and does not cross react with SUR1. SUR2B is a subunit of ATP-sensitive potassium channels (KATP). Can form cardiac and smooth muscle-type KATP channels with KCNJ11. KCNJ11 forms the channel pore while ABCC9
- Application Supplier NoteThis antibody is recommended for detection and analysis of SUR2B by immunocytochemistry, immunohistochemistry and western blot.
- ApplicationsWestern Blot, ImmunoCytoChemistry, ImmunoHistoChemistry
- Applications SupplierICC; IHC; WB
- CertificationResearch Use Only
- ClonalityMonoclonal
- Clone IDN323B/20
- Gene ID25560
- Target nameAbcc9
- Target descriptionATP binding cassette subfamily C member 9
- Target synonymsATP-binding cassette sub-family C member 9; ATP-binding cassette transporter sub-family C member 9; ATP-binding cassette, subfamily C (CFTR/MRP), member 9; ATP-binding cassette, sub-family C (CFTR/MRP), member 9; ATP-binding cassette, sub-family C, member 9-like; Sulfonylurea receptor 2; Sur2
- HostRabbit
- IsotypeIgG
- Protein IDQ63563
- Protein NameATP-binding cassette sub-family C member 9
- Scientific DescriptionThis chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques.
- ReactivityRat
- Reactivity Supplierrat
- Reactivity Supplier NoteThis antibody was raised by immunising BALB/c mice with a fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRA DM, cytoplasmic C-terminus) of rat SUR2B.
- Storage Instruction-20°C,2°C to 8°C
- UNSPSC12352203