Anti-SVOP [N356/23]
Ab02179-23.0
ApplicationsWestern Blot, ImmunoCytoChemistry
Product group Antibodies
ReactivityRat
TargetSvop
Overview
- SupplierAbsolute Antibody
- Product NameAnti-SVOP [N356/23]
- Delivery Days Customer7
- Antibody SpecificityThis antibody is specific for SVOP epitope: amino acids 1-85. The antibody does not cross-react with SVOPL/SVOP2. SVOP has transmembrane transporter activity.
- Application Supplier NoteThis antibody is recommended for detection and analysis of SVOP by western blot and immunocytochemistry. For instance, the mouse version of this antibody was used to detect SVOP by western blot in adult rat brain membranes and membranes from SVOP knockout and wild-type mice.
- ApplicationsWestern Blot, ImmunoCytoChemistry
- Applications SupplierWB; ICC
- CertificationResearch Use Only
- ClonalityMonoclonal
- Clone IDN356/23
- Gene ID171442
- Target nameSvop
- Target descriptionSV2 related protein
- Target synonymssynaptic vesicle 2-related protein; synaptic vesicle 2-related protein-like
- HostRabbit
- IsotypeIgG
- Scientific DescriptionThis chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques.
- ReactivityRat
- Reactivity Supplierrat
- Reactivity Supplier NoteThis antibody was raised by immunising BALB/c mice with SVOP epitope: amino acids 1-85 (MEEDLFQLRQLPVVKFRRTGESARSEDDAASGEHDVQIEGVRVGLEAVELDDGAAVPKEFANPTDDTFMVEDAVEAIGFGRFQWK, cytoplasmic N-terminus) of rat SVOP
- Storage Instruction-20°C,2°C to 8°C
- UNSPSC12352203