Anti-ZP2 [IE3]
Ab00954-2.0
ApplicationsImmunoFluorescence, ImmunoPrecipitation, Western Blot, ImmunoHistoChemistry, Neutralisation/Blocking
Product group Antibodies
ReactivityMouse
TargetZp2
Overview
- SupplierAbsolute Antibody
- Product NameAnti-ZP2 [IE3]
- Delivery Days Customer7
- Antibody SpecificityIE3 reacts specifically with ZP2 (East & Dean, 1984), where the specific epitope (TIKVVGGYQVNIRVGDTTTDVRYKDDMYHFFC) is at the N-terminus. ZP2 is a glycoprotein which forms the zona pellucida, an extracellular matrix surrounding mammalian oocytes. These gl
- Application Supplier NoteIE3 was shown to react with ZP2 by immunoprecipitation and immunofluorescence staining of various mouse tissue sections (East & Dean, 1984; Avella et al, 2014). IE3 was also shown to neutralise ZP2 activity in vivo by causing transient infertility in female mice.
- ApplicationsImmunoFluorescence, ImmunoPrecipitation, Western Blot, ImmunoHistoChemistry, Neutralisation/Blocking
- Applications SupplierWB; IP; IF; IHC; NTRL
- CertificationResearch Use Only
- ClonalityMonoclonal
- Clone IDIE3
- Gene ID22787
- Target nameZp2
- Target descriptionzona pellucida glycoprotein 2
- Target synonymszona pellucida glycoprotein ZP2; zona pellucida protein A; zona pellucida sperm-binding protein 2; Zp-; Zp-2
- HostMouse
- IsotypeIgG2a
- Protein IDP20239
- Protein NameZona pellucida sperm-binding protein 2
- Scientific DescriptionThis chimeric mouse antibody was made using the variable domain sequences of the original Rat IgG2a format, for improved compatibility with existing reagents, assays and techniques.
- ReactivityMouse
- Reactivity SupplierMouse
- Reactivity Supplier NoteOsbourne-Mendel rats were immunised with solubilised zonae pellucidae from DBA/2 mice. Splenocytes were obtained from immunised rats and fused with the SP2/2 murine myeloma cell line to generate hybridomas.
- Storage Instruction-20°C,2°C to 8°C
- UNSPSC12352203