PrEST Antigen DCBLD2
APREST71630
Overview
- SupplierAtlas Antibodies
- Product NamePrEST Antigen DCBLD2
- Delivery Days Customer7
- CertificationResearch Use Only
- Protein IDQ96PD2
- Protein NameDiscoidin, CUB and LCCL domain-containing protein 2
- Scientific DescriptionPrEST Antigen DCBLD2, Gene description: discoidin, CUB and LCCL domain containing 2, Alternative Gene Names: CLCP1, ESDN, Antigen sequence: AWHWRNRKKKTEGTYDLPYWDRAGWWKGMKQFLPAKAVDHEETPVRYSSSEVNHLSPREVTTVLQADSAEYAQPLVGGIVGTLHQRSTFKPEEGKEAGYADLDPYNSPGQEVYHAYAEPLPITGPEYATPIIMDMSGHPTTSVGQPST, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
- Storage Instruction-20°C
- UNSPSC12352202