PrEST Antigen SMC2
APREST88667
Overview
- SupplierAtlas Antibodies
- Product NamePrEST Antigen SMC2
- Delivery Days Customer7
- CertificationResearch Use Only
- Protein IDO95347
- Protein NameStructural maintenance of chromosomes protein 2
- Scientific DescriptionPrEST Antigen SMC2, Gene description: structural maintenance of chromosomes 2, Alternative Gene Names: CAP-E, hCAP-E, SMC2L1, Antigen sequence: LSRDIGRLKETYEALLARFPNLRFAYKDPEKNWNRNCVKGLVASLISVKDTSATTALELVAGERLYNVVVDTEVTGKKLLERGELKRRYTIIPLNKISARCIAPETLRVAQNLVGPD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
- Storage Instruction-20°C
- UNSPSC12352202