PrEST Antigen TACO1
APREST75708
Overview
- SupplierAtlas Antibodies
- Product NamePrEST Antigen TACO1
- Delivery Days Customer7
- CertificationResearch Use Only
- Protein IDQ9BSH4
- Protein NameTranslational activator of cytochrome c oxidase 1
- Scientific DescriptionPrEST Antigen TACO1, Gene description: translational activator of mitochondrially encoded cytochrome c oxidase I, Alternative Gene Names: CCDC44, Antigen sequence: FKFICDASSLHQVRKKLDSLGLCSVSCALEFIPNSKVQLAEPDLEQAAHLIQALSNHEDVIHVYDNI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
- Storage Instruction-20°C
- UNSPSC12352202