PrEST Antigen ZBTB42
APREST70413
Overview
- SupplierAtlas Antibodies
- Product NamePrEST Antigen ZBTB42
- Delivery Days Customer7
- CertificationResearch Use Only
- Protein IDB2RXF5
- Protein NameZinc finger and BTB domain-containing protein 42
- Scientific DescriptionPrEST Antigen ZBTB42, Gene description: zinc finger and BTB domain containing 42, Alternative Gene Names: ZNF925, Antigen sequence: LGFLCDCTVLVGDARFPAHRAVLAACSVYFHLFYRDRPAGSRDTVRLNGDIVTAPAFGRLLDFMYEGRLDLRSLPVEDVLAAASYLHMYDIVKVCKGRLQEKDRSLDPGNPAPGAEPAQPPC, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
- Storage Instruction-20°C
- UNSPSC12352202