PrEST Antigen SMC5
APREST75434
Overview
- SupplierAtlas Antibodies
- Product NamePrEST Antigen SMC5
- Delivery Days Customer7
- CertificationResearch Use Only
- Protein IDQ8IY18
- Protein NameStructural maintenance of chromosomes protein 5
- Scientific DescriptionPrEST Antigen SMC5, Gene description: structural maintenance of chromosomes 5, Alternative Gene Names: KIAA0594, SMC5L1, Antigen sequence: EVPSKRKNSAPQLPLLQSSGPFVEGSIVRISMENFLTYDICEVSPGPHLNMIVGANGTGKSSIVCAICLGLAGKPAFMGRADKVGFFVKRGCSRGMVEIELFRASGNLVITR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
- Storage Instruction-20°C
- UNSPSC12352202