
Amyloid Beta Peptide 40
CSR-KN-TOYU-M03
Product group Proteins
Overview
- SupplierCosmo Bio USA
- Product NameAmyloid Beta Peptide 40
- Delivery Days Customer16
- CertificationResearch Use Only
- Scientific DescriptionRecombinant Protein / Amyloid beta peptide 40 (A Beta40) Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV Warning: Store at 4°C. After reconstituted, store no longer than 1-2 days at 4°C, unless preservative is added.For long term storage, aliquot and store reconstituted product frozen at -20°C or lower. Aliquot to avoid cycles of freeze/thaw.
- UNSPSC12352202