More than 130 suppliers
ISO certified
In-house tech support
we Connect you
Bio-Connect
ProductsBack/Amyloid Beta Peptide 40
Amyloid Beta Peptide 40

Amyloid Beta Peptide 40

Research Use Only
CSR-KN-TOYU-M03
Cosmo Bio USA
Product group Proteins / Signaling Molecules
Sign in to order and to see your custom pricing.
Large volume orders?
Order with a bulk request
More than 130 suppliers
ISO certified
In-house tech support

Overview

  • Supplier
    Cosmo Bio USA
  • Product Name
    Amyloid Beta Peptide 40
  • Delivery Days Customer
    16
  • Certification
    Research Use Only
  • Scientific Description
    Recombinant Protein / Amyloid beta peptide 40 (A Beta40) Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV Warning: Store at 4°C. After reconstituted, store no longer than 1-2 days at 4°C, unless preservative is added.For long term storage, aliquot and store reconstituted product frozen at -20°C or lower. Aliquot to avoid cycles of freeze/thaw.
  • UNSPSC
    12352202