Anti-SUR1 [N289/16]
Ab02165-2.0
ApplicationsWestern Blot
Product group Antibodies
TargetAbcc8
Overview
- SupplierAbsolute Antibody
- Product NameAnti-SUR1 [N289/16]
- Delivery Days Customer7
- Application Supplier NoteThe IgG1 antibody was used for western blotting on CA1S cells (Bruin et al, 2014; PMID:24257076). Immunofluorescense was preformed with the IgG1 version of this antibody on HeLa cells (Karnik et al, 2013; PMID:24392021). The IgG1 version of this antibody was used to preform western blot on COS6m cells (Li et al, 2013; PMID:23798684).
- ApplicationsWestern Blot
- Applications SupplierWB
- CertificationResearch Use Only
- ClonalityMonoclonal
- Clone IDN289/16
- Gene ID25559
- Target nameAbcc8
- Target descriptionATP binding cassette subfamily C member 8
- Target synonymsSur, Sur1, ATP-binding cassette sub-family C member 8, ATP-binding cassette transporter sub-family C member 8, ATP-binding cassette, sub-family C (CFTR/MRP), member 8, ATP-binding cassette, subfamily C (CFTR/MRP), member 8, sulfonylurea receptor 1, sulphonylurea receptor 1
- HostMouse
- IsotypeIgG2a
- Protein IDQ09429
- Protein NameATP-binding cassette sub-family C member 8
- Reactivity Supplierrat, mouse, hamster
- Reactivity Supplier NoteThis antibody was raised by immunising BALB/c mice with a fusion protein amino acids 1548-1582 (LVMVLKRGAILEFDKPEKLLSQKDSVFASFVRADK, cytoplasmic C-terminus) of rat SUR1.
- Storage Instruction-20°C,2°C to 8°C
- UNSPSC12352203
Related products
Product group Antibodies
SUR1 AntibodyCSB-PA335816XA01SVG
ApplicationsWestern Blot, ELISA
ReactivityYeast
TargetSUR1
- SizePrice
