Chicken IL-2 Recombinant Protein
ORB1820919
Product group Proteins / Signaling Molecules
Overview
- SupplierBiorbyt
- Product NameChicken IL-2 Recombinant Protein
- Delivery Days Customer10
- CertificationResearch Use Only
- Estimated Purity98%
- Scientific DescriptionThe Chicken IL-2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IL-2 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken IL-2 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken IL-2 Specifications: (Molecular Weight: 14.0 kDa) (Amino Acid Sequence: ASLSSAKRKPLQTLIKDLEILENIKNKIHLELYTPTETQECTQQTLQCYLGEVVTLKKETEDDTEIKEEFVTAIQNIEKNLKSLTGLNHTGSECKICEANNKKKFPDFLHELTNFVRYLQK) (Gene ID: 373958).
- SourceChicken - Yeast
- Storage Instruction-20°C
- UNSPSC12352202