PrEST Antigen MAGI1
![Research Use Only](static/images/certificates/ruo.jpg)
APREST77896
Overview
- SupplierAtlas Antibodies
- Product NamePrEST Antigen MAGI1
- Delivery Days Customer7
- CertificationResearch Use Only
- Protein IDQ96QZ7
- Protein NameMembrane-associated guanylate kinase, WW and PDZ domain-containing protein 1
- Scientific DescriptionPrEST Antigen MAGI1, Gene description: membrane associated guanylate kinase, WW and PDZ domain containing 1, Alternative Gene Names: AIP3, BAIAP1, BAP1, MAGI-1, TNRC19, WWP3, Antigen sequence: PSQPVSGKVITTDALHSLQSGSKQSTPKRTKSYNDMQNAGIVHAENEEEDDVPEMNSSFTADSGEQEEHTLQETALPPVNSSIIAAPITDPSQKFPQY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
- Storage Instruction-20°C
- UNSPSC12352202