PrEST Antigen NOLC1
APREST80338
Overview
- SupplierAtlas Antibodies
- Product NamePrEST Antigen NOLC1
- Delivery Days Customer7
- CertificationResearch Use Only
- Protein IDQ14978
- Protein NameNucleolar and coiled-body phosphoprotein 1
- Scientific DescriptionPrEST Antigen NOLC1, Gene description: nucleolar and coiled-body phosphoprotein 1, Alternative Gene Names: KIAA0035, NOPP130, NOPP140, P130, Antigen sequence: VPSDLYPLVLGFLRDNQLSEVANKFAKATGATQQDANASSLLDIYSFWLKSAKVPERKLQANGPVAKKAKKK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
- Storage Instruction-20°C
- UNSPSC12352202