PrEST Antigen WAC
APREST80181
Overview
- SupplierAtlas Antibodies
- Product NamePrEST Antigen WAC
- Delivery Days Customer7
- CertificationResearch Use Only
- Protein IDQ9BTA9
- Protein NameWW domain-containing adapter protein with coiled-coil
- Scientific DescriptionPrEST Antigen WAC, Gene description: WW domain containing adaptor with coiled-coil, Alternative Gene Names: BM-016, FLJ31290, MGC10753, PRO1741, Wwp4, Antigen sequence: RLSDGCHDRRGDSQPYQALKYSSKSHPSSGDHRHEKMRDAGDPSPPNKMLRRSDSPENKYSDSTGHSKAKNVHTHRVRERDGGTSYSPQENSH, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
- Storage Instruction-20°C
- UNSPSC12352202