PrEST Antigen ZBTB34
![Research Use Only](static/images/certificates/ruo.jpg)
APREST75395
Overview
- SupplierAtlas Antibodies
- Product NamePrEST Antigen ZBTB34
- Delivery Days Customer7
- CertificationResearch Use Only
- Protein IDQ8NCN2
- Protein NameZinc finger and BTB domain-containing protein 34
- Scientific DescriptionPrEST Antigen ZBTB34, Gene description: zinc finger and BTB domain containing 34, Alternative Gene Names: KIAA1993, MGC24652, ZNF918, Antigen sequence: GSVSEYEIQIEGDHEQGDLLVRESQITEVKVKMEKSDRPSCSDSSSLGDDGYHTEMVDGEQVVAVNVGSYGSVLQHAYSYSQAA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
- Storage Instruction-20°C
- UNSPSC12352202