PDKtide
P10-58
Estimated PurityDetermined to be 95% by HPLC analysis.
Product group Chemicals
Molecular Weight4771.36
Overview
- SupplierSignalChem
- Product NamePDKtide
- Delivery Days Customer4
- CertificationResearch Use Only
- Estimated PurityDetermined to be 95% by HPLC analysis.
- Molecular Weight4771.36
- Scientific DescriptionThe 39 amino acids of PDKtide peptide sequence ([protein fragment, 39 aa]) is derived from two human proteins: residues 1-14 are based on AKT1 (307-320) and residues 16-39 are based on PKN2/PRK2 (961-984).
- Storage Instruction-20°C
- UNSPSC12352200