PrEST Antigen ANKK1
APREST71453
Overview
- SupplierAtlas Antibodies
- Product NamePrEST Antigen ANKK1
- Delivery Days Customer7
- CertificationResearch Use Only
- Protein IDQ8NFD2
- Protein NameAnkyrin repeat and protein kinase domain-containing protein 1
- Scientific DescriptionPrEST Antigen ANKK1, Gene description: ankyrin repeat and kinase domain containing 1, Alternative Gene Names: X-kinase, Antigen sequence: EVNEDISQELMDSDSGNYLKRALQLSDRKNLVPRDEELCIYENKVTPLHFLVAQGSVEQVRLLLAHEVDVDCQTASGYTPLLIAAQDQQPDLCALLLAHGADANRVDEDGWAPLHFAAQNGDDGTARLLLDHGACVDAQER, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
- Storage Instruction-20°C
- UNSPSC12352202