PrEST Antigen CCAR1
APREST71479
Overview
- SupplierAtlas Antibodies
- Product NamePrEST Antigen CCAR1
- Delivery Days Customer7
- CertificationResearch Use Only
- Protein IDQ8IX12
- Protein NameCell division cycle and apoptosis regulator protein 1
- Scientific DescriptionPrEST Antigen CCAR1, Gene description: cell division cycle and apoptosis regulator 1, Alternative Gene Names: CARP-1, CARP1, FLJ10590, Antigen sequence: KDVEENVGLIVYNGAMVDVGSLLQKLEKSEKVRAEVEQKLQLLEEKTDEDEKTILNLENSNKSLSGELREVKKDLSQLQENLKISENMNLQFENQMNKTIRNLSTVMDEIHTVLKKDNVKNED, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
- Storage Instruction-20°C
- UNSPSC12352202