PrEST Antigen CFAP70
![Research Use Only](static/images/certificates/ruo.jpg)
APREST80322
Overview
- SupplierAtlas Antibodies
- Product NamePrEST Antigen CFAP70
- Delivery Days Customer7
- CertificationResearch Use Only
- Protein IDQ5T0N1
- Protein NameCilia- and flagella-associated protein 70
- Scientific DescriptionPrEST Antigen CFAP70, Gene description: cilia and flagella associated protein 70, Alternative Gene Names: FLJ25765, Antigen sequence: AVVDLLPLLEGQSSFQTTVPLHPVQGSPLETPRSSAKQCSLEVKVLVAEPLLTTAQISGGNLLKVTLEAAYSVPESFIPTGPGQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
- Storage Instruction-20°C
- UNSPSC12352202