PrEST Antigen DMRT2
APREST84805
Overview
- SupplierAtlas Antibodies
- Product NamePrEST Antigen DMRT2
- Delivery Days Customer7
- CertificationResearch Use Only
- Protein IDQ9Y5R5
- Protein NameDoublesex- and mab-3-related transcription factor 2
- Scientific DescriptionPrEST Antigen DMRT2, Gene description: doublesex and mab-3 related transcription factor 2, Antigen sequence: VPGPDYNSYKSAYSPSPVEPPSKDFCNFLPTCLDLTMQYSGSGNMELISSNVSVATTYRQYPLSSRFLVWPKCGPISDTLLYQQCLLNATTSVQALKPGASWDLKGARVQDGLSAEQDMMPSKLEGSLVLPHTPEIQTTRSDLQGHQAVP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
- Storage Instruction-20°C
- UNSPSC12352202