PrEST Antigen DOCK8
APREST95170
Overview
- SupplierAtlas Antibodies
- Product NamePrEST Antigen DOCK8
- Delivery Days Customer7
- CertificationResearch Use Only
- Protein IDQ8NF50
- Protein NameDedicator of cytokinesis protein 8
- Scientific DescriptionPrEST Antigen DOCK8, Gene description: dedicator of cytokinesis 8, Alternative Gene Names: FLJ00026, FLJ00152, FLJ00346, ZIR8, Antigen sequence: INRYSSAEIRKQFTLPPNLGQYHRQSISTSGFPSLQLPQFYDPVEPVDFEGLLMTHLNSLDVQLAQELGDFTDDDLDVVF, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
- Storage Instruction-20°C
- UNSPSC12352202