PrEST Antigen DZANK1
APREST90073
Overview
- SupplierAtlas Antibodies
- Product NamePrEST Antigen DZANK1
- Delivery Days Customer7
- CertificationResearch Use Only
- Protein IDQ9NVP4
- Protein NameDouble zinc ribbon and ankyrin repeat-containing protein 1
- Scientific DescriptionPrEST Antigen DZANK1, Gene description: double zinc ribbon and ankyrin repeat domains 1, Alternative Gene Names: ANKRD64, bA189K21.8, C20orf12, C20orf84, dJ568F9.2, FLJ10600, FLJ30892, Antigen sequence: PGFAHVSGQKCLTSTEIMRIQRETDFLKCAHCLAPRPSDPFARFCQECGSPVPPIFGCRLPPPEGAQMGLCAECRSLVPMNTPICVVCE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
- Storage Instruction-20°C
- UNSPSC12352202