PrEST Antigen IFIT3
APREST85432
Overview
- SupplierAtlas Antibodies
- Product NamePrEST Antigen IFIT3
- Delivery Days Customer7
- CertificationResearch Use Only
- Protein IDO14879
- Protein NameInterferon-induced protein with tetratricopeptide repeats 3
- Scientific DescriptionPrEST Antigen IFIT3, Gene description: interferon-induced protein with tetratricopeptide repeats 3, Alternative Gene Names: CIG-49, GARG-49, IFI60, IFIT4, IRG2, ISG60, RIG-G, Antigen sequence: HKQNGDLLQAAKCYEKELGRLLRDAPSGIGSIFLSASELEDGSEEMGQGAVSSSPRELLSNSEQL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
- Storage Instruction-20°C
- UNSPSC12352202