PrEST Antigen LAT2
APREST86529
Overview
- SupplierAtlas Antibodies
- Product NamePrEST Antigen LAT2
- Delivery Days Customer7
- CertificationResearch Use Only
- Protein IDQ9GZY6
- Protein NameLinker for activation of T-cells family member 2
- Scientific DescriptionPrEST Antigen LAT2, Gene description: linker for activation of T cells family, member 2, Alternative Gene Names: HSPC046, LAB, NTAL, WBSCR15, WBSCR5, WSCR5, Antigen sequence: AKRSEKIYQQRSLREDQQSFTGSRTYSLVGQAWPGPLADMAPTRKDKLLQFYPSLEDPASSRYQNFSKGSRHGSEEAYIDPIAMEYYNWGRFSKPPEDDDANSYENVLICKQKTTETGAQQEGIGGLCRGDLSLSLALKTGPT, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
- Storage Instruction-20°C
- UNSPSC12352202