PrEST Antigen LRBA
APREST74669
Overview
- SupplierAtlas Antibodies
- Product NamePrEST Antigen LRBA
- Delivery Days Customer7
- CertificationResearch Use Only
- Protein IDP50851
- Protein NameLipopolysaccharide-responsive and beige-like anchor protein
- Scientific DescriptionPrEST Antigen LRBA, Gene description: LPS-responsive vesicle trafficking, beach and anchor containing, Alternative Gene Names: BGL, CDC4L, LAB300, LBA, Antigen sequence: SVLMVSKYRDILEPQNERHSQSCTETGSENENVSLSEITPAAFSTLTTASVEESESTSSARRRDSGIGEETATGLGSHVEVTPHTAPPGVSAGPDAISEVLSTLSLEVNKSPETKNDRGNDLDTKATPSVSV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
- Storage Instruction-20°C
- UNSPSC12352202