PrEST Antigen LRRIQ3
APREST76988
Overview
- SupplierAtlas Antibodies
- Product NamePrEST Antigen LRRIQ3
- Delivery Days Customer7
- CertificationResearch Use Only
- Protein IDA6PVS8
- Protein NameLeucine-rich repeat and IQ domain-containing protein 3
- Scientific DescriptionPrEST Antigen LRRIQ3, Gene description: leucine-rich repeats and IQ motif containing 3, Alternative Gene Names: LRRC44, MGC22773, Antigen sequence: MFHGTVTEELTSHEEWSHYNENIREGQKDFVFVKFNGLHLKSMENLQSCISLRVCIFSNNFITDIHPLQSCIKLIKLDLHGN, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
- Storage Instruction-20°C
- UNSPSC12352202