PrEST Antigen PAXBP1
APREST84806
Overview
- SupplierAtlas Antibodies
- Product NamePrEST Antigen PAXBP1
- Delivery Days Customer7
- CertificationResearch Use Only
- Protein IDQ9Y5B6
- Protein NamePAX3- and PAX7-binding protein 1
- Scientific DescriptionPrEST Antigen PAXBP1, Gene description: PAX3 and PAX7 binding protein 1, Alternative Gene Names: C21orf66, fSAP105, GCFC, GCFC1, Antigen sequence: ALSSLNVLRPGEIPDAAFIHAARKKRQMARELGDFTPHDNEPGKGRLVREDENDASDDEDDDEKRRIVFSVKEKSQRQKIAEEIGIEGSDDDALVTGEQDEELSRWEQEQIRKGINIPQVQASQPAEVNMYYQNT, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
- Storage Instruction-20°C
- UNSPSC12352202