PrEST Antigen PHRF1
APREST73673
Overview
- SupplierAtlas Antibodies
- Product NamePrEST Antigen PHRF1
- Delivery Days Customer7
- CertificationResearch Use Only
- Protein IDQ9P1Y6
- Protein NamePHD and RING finger domain-containing protein 1
- Scientific DescriptionPrEST Antigen PHRF1, Gene description: PHD and ring finger domains 1, Alternative Gene Names: KIAA1542, RNF221, Antigen sequence: SCIPSVLKPVEPSLGLLRADIGAASLSLFGDPYELDPFDSSEELSANPLSPLSAKRRALSRSALQSHQPVARPVSVGLSRRRLPAAVPEPDLEEEPVPDLLGSILSGQSLLMLGSSDVIIHRDGSLSAKRAAPVSFQR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
- Storage Instruction-20°C
- UNSPSC12352202