PrEST Antigen PTEN
APREST87042
Overview
- SupplierAtlas Antibodies
- Product NamePrEST Antigen PTEN
- Delivery Days Customer7
- CertificationResearch Use Only
- Protein IDP60484
- Protein NamePhosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN
- Scientific DescriptionPrEST Antigen PTEN, Gene description: phosphatase and tensin homolog, Alternative Gene Names: BZS, MHAM, MMAC1, PTEN1, TEP1, Antigen sequence: VAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRT, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
- Storage Instruction-20°C
- UNSPSC12352202