Bio-Connect

PrEST Antigen PVR

Research Use Only
APREST71644
Atlas Antibodies
Protein IDP15151
Product group Proteins / Signaling Molecules
Price on request
Packing Size
Large volume orders?
Order with a bulk request

Overview

  • Supplier
    Atlas Antibodies
  • Product Name
    PrEST Antigen PVR
  • Delivery Days Customer
    7
  • Certification
    Research Use Only
  • Protein IDP15151
  • Protein Name
    Poliovirus receptor
  • Scientific Description
    PrEST Antigen PVR, Gene description: poliovirus receptor, Alternative Gene Names: CD155, HVED, Necl-5, NECL5, PVS, Tage4, Antigen sequence: DVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
  • Storage Instruction
    -20°C
  • UNSPSC
    12352202

Related products

Product group Proteins / Signaling Molecules
Atlas Antibodies
Protein IDP15151
  • SizePrice
Immunohistochemistry analysis in human placenta and tonsil tissues using HPA012568 antibody. Corresponding PVR RNA-seq data are presented for the same tissues.
Product group Antibodies
Atlas Antibodies
Anti-PVRHPA012568
ApplicationsWestern Blot, ImmunoHistoChemistry
ReactivityHuman
TargetPVR
  • SizePrice
Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.
Product group Antibodies
Atlas Antibodies
Anti-PVRHPA064739
ApplicationsImmunoHistoChemistry
ReactivityHuman
TargetPVR
  • SizePrice