PrEST Antigen RTEL1
![Research Use Only](static/images/certificates/ruo.jpg)
APREST94055
Overview
- SupplierAtlas Antibodies
- Product NamePrEST Antigen RTEL1
- Delivery Days Customer7
- CertificationResearch Use Only
- Protein IDQ9NZ71
- Protein NameRegulator of telomere elongation helicase 1
- Scientific DescriptionPrEST Antigen RTEL1, Gene description: regulator of telomere elongation helicase 1, Alternative Gene Names: bK3184A7.3, C20orf41, DKFZP434C013, KIAA1088, NHL, RTEL, Antigen sequence: VFTNTAGLQKLADIIQIVFSVDPSEGSPGSPAGLGALQSYKVHIHPDAGHRRTAQRSDAWSTTAARKRGKVLSYWCFSPGHSMHELVRQGVRSLILTSGTLAPVSSFALEMQIPFPVCLENPHIIDKHQIWV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
- Storage Instruction-20°C
- UNSPSC12352202