PrEST Antigen TNIK
APREST71436
Overview
- SupplierAtlas Antibodies
- Product NamePrEST Antigen TNIK
- Delivery Days Customer7
- CertificationResearch Use Only
- Protein IDQ9UKE5
- Protein NameTRAF2 and NCK-interacting protein kinase
- Scientific DescriptionPrEST Antigen TNIK, Gene description: TRAF2 and NCK interacting kinase, Alternative Gene Names: KIAA0551, Antigen sequence: QGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPDLRRTEPILESPLQRTSSGSSSSSS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
- Storage Instruction-20°C
- UNSPSC12352202