PrEST Antigen VWCE
APREST80712
Overview
- SupplierAtlas Antibodies
- Product NamePrEST Antigen VWCE
- Delivery Days Customer7
- CertificationResearch Use Only
- Protein IDQ96DN2
- Protein Namevon Willebrand factor C and EGF domain-containing protein
- Scientific DescriptionPrEST Antigen VWCE, Gene description: von Willebrand factor C and EGF domains, Alternative Gene Names: FLJ32009, URG11, VWC1, Antigen sequence: GGDECTTCVCQNGEVECSFMPCPELACPREEWRLGPGQCCFTCQEPTPSTGCSLDDNGVEFPIGQIWSPGDPCELCICQADGSVSCKRTDCVDSCP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
- Storage Instruction-20°C
- UNSPSC12352202