PrEST Antigen ZBTB38
APREST73338
Overview
- SupplierAtlas Antibodies
- Product NamePrEST Antigen ZBTB38
- Delivery Days Customer7
- CertificationResearch Use Only
- Protein IDQ8NAP3
- Protein NameZinc finger and BTB domain-containing protein 38
- Scientific DescriptionPrEST Antigen ZBTB38, Gene description: zinc finger and BTB domain containing 38, Alternative Gene Names: CIBZ, FLJ35036, ZNF921, Antigen sequence: PVLSLSNSSENAASVISYSGSAPSVIVHSSQFSSVIMHSNAIAAMTSSNHRAFSDPAVSQSLKDDSKPEPDKVGRFASRPKSIKEKKKTTSHTRGEIPEESNYVADPGGSLSKTTNIAEETSKIET, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
- Storage Instruction-20°C
- UNSPSC12352202