PrEST Antigen ZBTB7B
APREST70952
Overview
- SupplierAtlas Antibodies
- Product NamePrEST Antigen ZBTB7B
- Delivery Days Customer7
- CertificationResearch Use Only
- Protein IDO15156
- Protein NameZinc finger and BTB domain-containing protein 7B
- Scientific DescriptionPrEST Antigen ZBTB7B, Gene description: zinc finger and BTB domain containing 7B, Alternative Gene Names: c-Krox, hcKrox, ZBTB15, ZFP67, ZNF857B, Antigen sequence: AHPLTYEEEEVAGRVGSSGGSGPGDSYSPPTGTASPPEGPQSYEPYEGEEEEEELVYPPAYGLAQGGGPPLSPEELGSDEDAIDPDLMAYLSSLHQDNLAPGLDSQDKLVRKRRSQMPQECPVCHKII, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
- Storage Instruction-20°C
- UNSPSC12352202