PrEST Antigen ZHX2
APREST70990
Overview
- SupplierAtlas Antibodies
- Product NamePrEST Antigen ZHX2
- Delivery Days Customer7
- CertificationResearch Use Only
- Protein IDQ9Y6X8
- Protein NameZinc fingers and homeoboxes protein 2
- Scientific DescriptionPrEST Antigen ZHX2, Gene description: zinc fingers and homeoboxes 2, Alternative Gene Names: KIAA0854, Antigen sequence: PQEYDQLAAKTGLVRTEIVRWFKENRCLLKTGTVKWMEQYQHQPMADDHGYDAVARKATKPMAESPKNGGDVVPQYYKDPKKLCEEDLEKLVTRVKVGSEPAKDCLPAKPSEATSDRSEGSSRDGQGSDENEESSVVDYV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
- Storage Instruction-20°C
- UNSPSC12352202