PrEST Antigen ZSCAN1
APREST70941
Overview
- SupplierAtlas Antibodies
- Product NamePrEST Antigen ZSCAN1
- Delivery Days Customer7
- CertificationResearch Use Only
- Protein IDQ8NBB4
- Protein NameZinc finger and SCAN domain-containing protein 1
- Scientific DescriptionPrEST Antigen ZSCAN1, Gene description: zinc finger and SCAN domain containing 1, Alternative Gene Names: FLJ33779, ZNF915, Antigen sequence: QPSLKHTKGGTQEAVAGISVVPRGPRGGRPFQCADCGMVFTWVTHFIEHQKTHREEGPFPCPECGKVFLHNSVLTEHGKIHLLEPPRKKAPRSKGPRESVPPRDGAQGPVAPRSPKRPFQCSVCGKAFPWMVHLIDHQKL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
- Storage Instruction-20°C
- UNSPSC12352202