PrEST Antigen ZSCAN12
APREST70950
Overview
- SupplierAtlas Antibodies
- Product NamePrEST Antigen ZSCAN12
- Delivery Days Customer7
- CertificationResearch Use Only
- Protein IDO43309
- Protein NameZinc finger and SCAN domain-containing protein 12
- Scientific DescriptionPrEST Antigen ZSCAN12, Gene description: zinc finger and SCAN domain containing 12, Alternative Gene Names: dJ29K1.2, KIAA0426, ZFP96, ZNF29K1, ZNF305, ZNF96, Antigen sequence: IIHTGEKPYKCNECGKAFGRWSALNQHQRLHTGEKHYHCNDCGKAFSQKAGLFHHIKIHTRDKPYQCTQCNKSFSRRSILTQHQGVHTGAKPYECNECGKAFVYNSSLVSHQEIHHK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
- Storage Instruction-20°C
- UNSPSC12352202