
Transthyretin (His-Tag)
CSR-KN-TOYU-M01
Product group Proteins / Signaling Molecules
Overview
- SupplierCosmo Bio USA
- Product NameTransthyretin (His-Tag)
- Delivery Days Customer16
- CertificationResearch Use Only
- Scientific DescriptionRecombinant Protein / Transthyretin (His-Tag) Sequence: MRGSHHHHHHGSGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIA ALLSPYSYSTTAVVTNPKE Warning: Store at 4°C. After reconstituted, store no longer than 1-2 days at 4°C, unless preservative is added.For long term storage, aliquot and store reconstituted product frozen at -20°C or lower. Aliquot to avoid cycles of freeze/thaw.
- Storage Instruction2°C to 8°C
- UNSPSC41116100