PrEST Antigen ASZ1
![Research Use Only](static/images/certificates/ruo.jpg)
APREST75024
Overview
- SupplierAtlas Antibodies
- Product NamePrEST Antigen ASZ1
- Delivery Days Customer7
- CertificationResearch Use Only
- Protein IDQ8WWH4
- Protein NameAnkyrin repeat, SAM and basic leucine zipper domain-containing protein 1
- Scientific DescriptionPrEST Antigen ASZ1, Gene description: ankyrin repeat, SAM and basic leucine zipper domain containing 1, Alternative Gene Names: ALP1, ANKL1, C7orf7, CT1.19, GASZ, Orf3, Antigen sequence: DGHTQVVALLVAHGAEVNTQDENGYTALTWAARQGHKNIVLKLLELGANKMLQTKDGKMPSEIAKRNKHHEIFNLLSFTLNPLEGKLQQLTKED, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
- Storage Instruction-20°C
- UNSPSC12352202