PrEST Antigen OGFOD3
APREST71316
Overview
- SupplierAtlas Antibodies
- Product NamePrEST Antigen OGFOD3
- Delivery Days Customer7
- CertificationResearch Use Only
- Protein IDQ6PK18
- Protein Name2-oxoglutarate and iron-dependent oxygenase domain-containing protein 3
- Scientific DescriptionPrEST Antigen OGFOD3, Gene description: 2-oxoglutarate and iron-dependent oxygenase domain containing 3, Alternative Gene Names: C17orf101, FLJ22222, Antigen sequence: RGVTDVVITREEAERIRSVAEKGLSLGGSDGGASILDLHSGALSVGKHFVNLYRYFGDKIQNIFSEEDFRLYREVRQKVQLTIAEAFGISASSLHLTKPTFFSRINSTEARTAHDEYWHAHVDKVTYGS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
- Storage Instruction-20°C
- UNSPSC12352202