PrEST Antigen POGZ
APREST71074
Overview
- SupplierAtlas Antibodies
- Product NamePrEST Antigen POGZ
- Delivery Days Customer7
- CertificationResearch Use Only
- Protein IDQ7Z3K3
- Protein NamePogo transposable element with ZNF domain
- Scientific DescriptionPrEST Antigen POGZ, Gene description: pogo transposable element with ZNF domain, Alternative Gene Names: KIAA0461, SUHW5, ZNF280E, ZNF635m, Antigen sequence: GEPWCDVVLAILADGTVLPTLVFYRGQMDQPANMPDSILLEAKESGYSDDEIMELWSTRVWQKHTACQRSKGMLVMDCHRTHLSEEVLAMLSASSTLPAVVPAGCSSKIQPLDVCIKRTVKNFLH, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
- Storage Instruction-20°C
- UNSPSC12352202