PrEST Antigen SMCHD1
APREST81743
Overview
- SupplierAtlas Antibodies
- Product NamePrEST Antigen SMCHD1
- Delivery Days Customer7
- CertificationResearch Use Only
- Protein IDA6NHR9
- Protein NameStructural maintenance of chromosomes flexible hinge domain-containing protein 1
- Scientific DescriptionPrEST Antigen SMCHD1, Gene description: structural maintenance of chromosomes flexible hinge domain containing 1, Alternative Gene Names: KIAA0650, Antigen sequence: DNGRGMTSKQLNNWAVYRLSKFTRQGDFESDHSGYVRPVPVPRSLNSDISYFGVGGKQAVFFVGQSARMISKPADSQDVHELVLSKED, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
- Storage Instruction-20°C
- UNSPSC12352202