Anti-ROS1 [ROS1-5F2]
Ab03010-3.0
ApplicationsWestern Blot, ELISA
Product group Antibodies
ReactivityHuman
TargetROS1
Overview
- SupplierAbsolute Antibody
- Product NameAnti-ROS1 [ROS1-5F2]
- Delivery Days Customer7
- Application Supplier NoteThe binding specificity of this antibody for ROS1 was determined using ELISA. This antibody was also capable of detection the ROS1 kinase domain polypeptide in a western blot assay. The original IgG2b version of this antibody was capable of binding the antigen with a high affinity and the dissociation constant reaches Kd=3.56x10-11M. The affinity measurement was done using surface plasmon resonance. This antibody showed a good inhibitory effect on hepatocellular carcinoma cells (HepG2) in a CCK-8 cytotoxicity test (CN111440241).
- ApplicationsWestern Blot, ELISA
- Applications SupplierELISA; WB
- CertificationResearch Use Only
- ClonalityMonoclonal
- Clone IDROS1-5F2
- Gene ID6098
- Target nameROS1
- Target descriptionROS proto-oncogene 1, receptor tyrosine kinase
- Target synonymsMCF3, ROS, c-ros-1, proto-oncogene tyrosine-protein kinase ROS, ROS proto-oncogene 1 , receptor tyrosine kinase, c-ros oncogene 1 , receptor tyrosine kinase, proto-oncogene c-Ros-1, transmembrane tyrosine-specific protein kinase, v-ros avian UR2 sarcoma virus oncogene homolog 1
- HostMouse
- IsotypeIgG2b
- Protein IDP08922
- Protein NameProto-oncogene tyrosine-protein kinase ROS
- ReactivityHuman
- Reactivity SupplierHuman
- Reactivity Supplier NoteThe original antibody was generated by immunizing mice intramuscularly with purified peptide 'GGDLLTYLRKARMATFYGPLLTLVDLVDLCVDISKGCVYLERMHFIHRDLAARNCLVSVKDYTSPRIVKIGDFGLARDIYKNDYYRKRGEGLLPVRWMAPESLMDGIFTTQSDVWSFGIL' and immune enhancer PEI in a ratio of 1:3 and dissolved in a serum free and dual-antibody-free DMEM solution. The purified peptide is identified as a specific binding fragment of PF-06463922 (Crizotinib, Xalkori).
- Storage Instruction-20°C,2°C to 8°C
- UNSPSC41116161







