Anti-ROS1 [ROS1-5F2]
Ab03010-3.3
ApplicationsWestern Blot, ELISA
Product group Antibodies
ReactivityHuman
TargetROS1
Overview
- SupplierAbsolute Antibody
- Product NameAnti-ROS1 [ROS1-5F2]
- Delivery Days Customer7
- Antibody SpecificityThis antibody binds ROS1 kinase domain. Mutations, rearrangements, and overexpression of the ROS1 gene can all lead to the imbalance of the ROS1 kinase protein, and the abnormal ROS1 protein kinase activity activates multiple downstream oncogenic signal p
- Application Supplier NoteThe binding specificity of this antibody for ROS1 was determined using ELISA. This antibody was also capable of detection the ROS1 kinase domain polypeptide in a western blot assay. The original IgG2b version of this antibody was capable of binding the antigen with a high affinity and the dissociation constant reaches Kd=3.56x10-11M. The affinity measurement was done using surface plasmon resonance. This antibody showed a good inhibitory effect on hepatocellular carcinoma cells (HepG2) in a CCK-8 cytotoxicity test (CN111440241).
- ApplicationsWestern Blot, ELISA
- Applications SupplierELISA; WB
- CertificationResearch Use Only
- ClonalityMonoclonal
- Clone IDROS1-5F2
- Gene ID6098
- Target nameROS1
- Target descriptionROS proto-oncogene 1, receptor tyrosine kinase
- Target synonymsc-ros oncogene 1 , receptor tyrosine kinase; c-ros-1; MCF3; proto-oncogene c-Ros-1; proto-oncogene tyrosine-protein kinase ROS; ROS; ROS proto-oncogene 1 , receptor tyrosine kinase; transmembrane tyrosine-specific protein kinase; v-ros avian UR2 sarcoma virus oncogene homolog 1
- HostMouse
- IsotypeIgG2b
- Protein IDP08922
- Protein NameProto-oncogene tyrosine-protein kinase ROS
- ReactivityHuman
- Reactivity SupplierHuman
- Reactivity Supplier NoteThe original antibody was generated by immunizing mice intramuscularly with purified peptide 'GGDLLTYLRKARMATFYGPLLTLVDLVDLCVDISKGCVYLERMHFIHRDLAARNCLVSVKDYTSPRIVKIGDFGLARDIYKNDYYRKRGEGLLPVRWMAPESLMDGIFTTQSDVWSFGIL' and immune enhancer PEI in a ratio of 1:3 and dissolved in a serum free and dual-antibody-free DMEM solution. The purified peptide is identified as a specific binding fragment of PF-06463922 (Crizotinib, Xalkori).
- Storage Instruction-20°C,2°C to 8°C
- UNSPSC12352203